ZNRD1 polyclonal antibody (A01) View larger

ZNRD1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNRD1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ZNRD1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00030834-A01
Product name: ZNRD1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ZNRD1.
Gene id: 30834
Gene name: ZNRD1
Gene alias: HTEX-6|MGC13376|Rpa12|TEX6|hZR14|tctex-6
Gene description: zinc ribbon domain containing 1
Genbank accession: NM_014596
Immunogen: ZNRD1 (NP_055411, 24 a.a. ~ 126 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: GSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
Protein accession: NP_055411
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00030834-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNRD1 polyclonal antibody (A01) now

Add to cart