KCNIP1 monoclonal antibody (M10), clone 3D9 View larger

KCNIP1 monoclonal antibody (M10), clone 3D9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KCNIP1 monoclonal antibody (M10), clone 3D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about KCNIP1 monoclonal antibody (M10), clone 3D9

Brand: Abnova
Reference: H00030820-M10
Product name: KCNIP1 monoclonal antibody (M10), clone 3D9
Product description: Mouse monoclonal antibody raised against a full-length recombinant KCNIP1.
Clone: 3D9
Isotype: IgG2a Kappa
Gene id: 30820
Gene name: KCNIP1
Gene alias: KCHIP1|MGC95|VABP
Gene description: Kv channel interacting protein 1
Genbank accession: BC050375
Immunogen: KCNIP1 (AAH50375, 1 a.a. ~ 216 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM
Protein accession: AAH50375
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00030820-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (49.5 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00030820-M10-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged KCNIP1 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KCNIP1 monoclonal antibody (M10), clone 3D9 now

Add to cart