Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Brand: | Abnova |
Reference: | H00030819-M01 |
Product name: | KCNIP2 monoclonal antibody (M01), clone 3E7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant KCNIP2. |
Clone: | 3E7 |
Isotype: | IgG1 Kappa |
Gene id: | 30819 |
Gene name: | KCNIP2 |
Gene alias: | DKFZp566L1246|KCHIP2|MGC17241 |
Gene description: | Kv channel interacting protein 2 |
Genbank accession: | BC034685 |
Immunogen: | KCNIP2 (AAH34685, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNEC |
Protein accession: | AAH34685 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of KCNIP2 expression in transfected 293T cell line by KCNIP2 monoclonal antibody (M01), clone 3E7. Lane 1: KCNIP2 transfected lysate(30.919 KDa). Lane 2: Non-transfected lysate. |
Applications: | IHC-P,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |