KCNIP2 monoclonal antibody (M01), clone 3E7 View larger

KCNIP2 monoclonal antibody (M01), clone 3E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KCNIP2 monoclonal antibody (M01), clone 3E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about KCNIP2 monoclonal antibody (M01), clone 3E7

Brand: Abnova
Reference: H00030819-M01
Product name: KCNIP2 monoclonal antibody (M01), clone 3E7
Product description: Mouse monoclonal antibody raised against a partial recombinant KCNIP2.
Clone: 3E7
Isotype: IgG1 Kappa
Gene id: 30819
Gene name: KCNIP2
Gene alias: DKFZp566L1246|KCHIP2|MGC17241
Gene description: Kv channel interacting protein 2
Genbank accession: BC034685
Immunogen: KCNIP2 (AAH34685, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNEC
Protein accession: AAH34685
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00030819-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00030819-M01-13-15-1.jpg
Application image note: Western Blot analysis of KCNIP2 expression in transfected 293T cell line by KCNIP2 monoclonal antibody (M01), clone 3E7.

Lane 1: KCNIP2 transfected lysate(30.919 KDa).
Lane 2: Non-transfected lysate.
Applications: IHC-P,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy KCNIP2 monoclonal antibody (M01), clone 3E7 now

Add to cart