KCNIP2 purified MaxPab mouse polyclonal antibody (B01P) View larger

KCNIP2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KCNIP2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about KCNIP2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00030819-B01P
Product name: KCNIP2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human KCNIP2 protein.
Gene id: 30819
Gene name: KCNIP2
Gene alias: DKFZp566L1246|KCHIP2|MGC17241
Gene description: Kv channel interacting protein 2
Genbank accession: NM_173191.2
Immunogen: KCNIP2 (NP_775283.1, 1 a.a. ~ 270 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI
Protein accession: NP_775283.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00030819-B01P-13-15-1.jpg
Application image note: Western Blot analysis of KCNIP2 expression in transfected 293T cell line (H00030819-T01) by KCNIP2 MaxPab polyclonal antibody.

Lane 1: KCNIP2 transfected lysate(29.7 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KCNIP2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart