H00030816-M06_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Clonality | Monoclonal |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ERVWE1. |
Clone: | 4F10 |
Isotype: | IgG1 Kappa |
Gene id: | 30816 |
Gene name: | ERVWE1 |
Gene alias: | Env-W|HERV-7q|HERV-W|HERV-W-ENV|HERVW|env|syncytin |
Gene description: | endogenous retroviral family W, env(C7), member 1 |
Genbank accession: | NM_014590 |
Immunogen: | ERVWE1 (NP_055405, 116 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLRTHTRLVSLFNTTLTGLHEVSAQNPTNCWICLPLNFRPYVSIPVPEQWNNFSTEINT |
Protein accession: | NP_055405 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Size: | 100 ug |
Shipping condition: | Dry Ice |