Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00030815-B02P |
Product name: | ST6GALNAC6 purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human ST6GALNAC6 protein. |
Gene id: | 30815 |
Gene name: | ST6GALNAC6 |
Gene alias: | RP11-203J24.3|SIAT7F|ST6GALNACVI |
Gene description: | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 |
Genbank accession: | NM_013443.3 |
Immunogen: | ST6GALNAC6 (NP_038471.2, 1 a.a. ~ 333 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT |
Protein accession: | NP_038471.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ST6GALNAC6 expression in transfected 293T cell line (H00030815-T02) by ST6GALNAC6 MaxPab polyclonal antibody. Lane 1: ST6GALNAC6 transfected lysate(36.63 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |