PLA2G2E purified MaxPab rabbit polyclonal antibody (D01P) View larger

PLA2G2E purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLA2G2E purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Tr

More info about PLA2G2E purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00030814-D01P
Product name: PLA2G2E purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human PLA2G2E protein.
Gene id: 30814
Gene name: PLA2G2E
Gene alias: -
Gene description: phospholipase A2, group IIE
Genbank accession: BC141619
Immunogen: PLA2G2E (AAI41620.1, 1 a.a. ~ 142 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKSPHVLVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC
Protein accession: AAI41620.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00030814-D01P-1-9-1.jpg
Application image note: PLA2G2E MaxPab rabbit polyclonal antibody. Western Blot analysis of PLA2G2E expression in K-562.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PLA2G2E purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart