Cart 136 Product Products 51 268,80 € (empty)
No products
265,00 € DAP Shipping
51 533,80 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 136 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 51 268,80 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 51 533,80 €
Data sheet of PLA2G2E purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Tr |
More info about PLA2G2E purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00030814-D01P |
| Product name: | PLA2G2E purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human PLA2G2E protein. |
| Gene id: | 30814 |
| Gene name: | PLA2G2E |
| Gene alias: | - |
| Gene description: | phospholipase A2, group IIE |
| Genbank accession: | BC141619 |
| Immunogen: | PLA2G2E (AAI41620.1, 1 a.a. ~ 142 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MKSPHVLVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC |
| Protein accession: | AAI41620.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PLA2G2E MaxPab rabbit polyclonal antibody. Western Blot analysis of PLA2G2E expression in K-562. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |