SOX8 monoclonal antibody (M01), clone 8G7 View larger

SOX8 monoclonal antibody (M01), clone 8G7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SOX8 monoclonal antibody (M01), clone 8G7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about SOX8 monoclonal antibody (M01), clone 8G7

Brand: Abnova
Reference: H00030812-M01
Product name: SOX8 monoclonal antibody (M01), clone 8G7
Product description: Mouse monoclonal antibody raised against a partial recombinant SOX8.
Clone: 8G7
Isotype: IgG2a Kappa
Gene id: 30812
Gene name: SOX8
Gene alias: MGC24837
Gene description: SRY (sex determining region Y)-box 8
Genbank accession: NM_014587
Immunogen: SOX8 (NP_055402, 102 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSAKAGHSDSDSGAELGPHPGGGAVYKAEAGLGD
Protein accession: NP_055402
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00030812-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00030812-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to SOX8 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SOX8 monoclonal antibody (M01), clone 8G7 now

Add to cart