HUNK monoclonal antibody (M03), clone 2G3 View larger

HUNK monoclonal antibody (M03), clone 2G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HUNK monoclonal antibody (M03), clone 2G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HUNK monoclonal antibody (M03), clone 2G3

Brand: Abnova
Reference: H00030811-M03
Product name: HUNK monoclonal antibody (M03), clone 2G3
Product description: Mouse monoclonal antibody raised against a partial recombinant HUNK.
Clone: 2G3
Isotype: IgG2a Kappa
Gene id: 30811
Gene name: HUNK
Gene alias: -
Gene description: hormonally up-regulated Neu-associated kinase
Genbank accession: NM_014586
Immunogen: HUNK (NP_055401, 615 a.a. ~ 714 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIGQMLRKRHQSLQPSADRPLEASLPPLQPLAPVNLAFDMADGVKTQC
Protein accession: NP_055401
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00030811-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00030811-M03-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged HUNK is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HUNK monoclonal antibody (M03), clone 2G3 now

Add to cart