RAX (Human) Recombinant Protein (Q01) View larger

RAX (Human) Recombinant Protein (Q01)

New product

527,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAX (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
ApplicationsAP,Array,ELISA,WB-Re

More info about RAX (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00030062-Q01
Product name: RAX (Human) Recombinant Protein (Q01)
Product description: Human RAX partial ORF (NP_038463.2, 104 a.a. - 206 a.a.) recombinant protein with GST tag at N-terminal.
Gene id: 30062
Gene name: RAX
Gene alias: MCOP3|RX
Gene description: retina and anterior neural fold homeobox
Genbank accession: no gene_acc
Immunogen sequence/protein sequence: KEPWEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEKLEVSSMKLQD
Protein accession: NP_038463.2
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-H00030062-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RAX (Human) Recombinant Protein (Q01) now

Add to cart