Brand: | Abnova |
Reference: | H00030062-M05 |
Product name: | RAX monoclonal antibody (M05), clone 3G8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant RAX. |
Clone: | 3G8 |
Isotype: | IgG2a Kappa |
Gene id: | 30062 |
Gene name: | RAX |
Gene alias: | MCOP3|RX |
Gene description: | retina and anterior neural fold homeobox |
Genbank accession: | NM_013435 |
Immunogen: | RAX (NP_038463, 104 a.a. ~ 206 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KEPWEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEKLEVSSMKLQD |
Protein accession: | NP_038463 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.33 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged RAX is approximately 1ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |