Brand: | Abnova |
Reference: | H00030012-M02 |
Product name: | TLX3 monoclonal antibody (M02), clone 5B11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TLX3. |
Clone: | 5B11 |
Isotype: | IgG1 Kappa |
Gene id: | 30012 |
Gene name: | TLX3 |
Gene alias: | HOX11L2|MGC29804|RNX |
Gene description: | T-cell leukemia homeobox 3 |
Genbank accession: | NM_021025 |
Immunogen: | TLX3 (NP_066305, 192 a.a. ~ 291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTSLV |
Protein accession: | NP_066305 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TLX3 is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |