Brand: | Abnova |
Reference: | H00030011-M01 |
Product name: | SH3KBP1 monoclonal antibody (M01), clone 1F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SH3KBP1. |
Clone: | 1F11 |
Isotype: | IgG2a Kappa |
Gene id: | 30011 |
Gene name: | SH3KBP1 |
Gene alias: | CIN85|GIG10|MIG18 |
Gene description: | SH3-domain kinase binding protein 1 |
Genbank accession: | NM_031892 |
Immunogen: | SH3KBP1 (NP_114098.1, 224 a.a. ~ 308 a.a) partial recombinant protein with GST-pstS1 tag. |
Immunogen sequence/protein sequence: | IKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWE |
Protein accession: | NP_114098.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SH3KBP1 monoclonal antibody (M01), clone 1F11. Western Blot analysis of SH3KBP1 expression in IMR-32. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |