SH3KBP1 monoclonal antibody (M01), clone 1F11 View larger

SH3KBP1 monoclonal antibody (M01), clone 1F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SH3KBP1 monoclonal antibody (M01), clone 1F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about SH3KBP1 monoclonal antibody (M01), clone 1F11

Brand: Abnova
Reference: H00030011-M01
Product name: SH3KBP1 monoclonal antibody (M01), clone 1F11
Product description: Mouse monoclonal antibody raised against a partial recombinant SH3KBP1.
Clone: 1F11
Isotype: IgG2a Kappa
Gene id: 30011
Gene name: SH3KBP1
Gene alias: CIN85|GIG10|MIG18
Gene description: SH3-domain kinase binding protein 1
Genbank accession: NM_031892
Immunogen: SH3KBP1 (NP_114098.1, 224 a.a. ~ 308 a.a) partial recombinant protein with GST-pstS1 tag.
Immunogen sequence/protein sequence: IKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWE
Protein accession: NP_114098.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00030011-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00030011-M01-1-19-1.jpg
Application image note: SH3KBP1 monoclonal antibody (M01), clone 1F11. Western Blot analysis of SH3KBP1 expression in IMR-32.
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SH3KBP1 monoclonal antibody (M01), clone 1F11 now

Add to cart