TBX21 monoclonal antibody (M10), clone 2F10 View larger

TBX21 monoclonal antibody (M10), clone 2F10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TBX21 monoclonal antibody (M10), clone 2F10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about TBX21 monoclonal antibody (M10), clone 2F10

Brand: Abnova
Reference: H00030009-M10
Product name: TBX21 monoclonal antibody (M10), clone 2F10
Product description: Mouse monoclonal antibody raised against a partial recombinant TBX21.
Clone: 2F10
Isotype: IgG2a Kappa
Gene id: 30009
Gene name: TBX21
Gene alias: T-PET|T-bet|TBET|TBLYM
Gene description: T-box 21
Genbank accession: NM_013351
Immunogen: TBX21 (NP_037483, 400 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RAVSMKPAFLPSAPGPTMSYYRGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPESSDSGLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPN
Protein accession: NP_037483
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00030009-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (40.59 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00030009-M10-2-A4-1.jpg
Application image note: TBX21 monoclonal antibody (M10), clone 2F10. Western Blot analysis of TBX21 expression in human spleen.
Applications: WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TBX21 monoclonal antibody (M10), clone 2F10 now

Add to cart