Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00030009-M09 |
Product name: | TBX21 monoclonal antibody (M09), clone 1D12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TBX21. |
Clone: | 1D12 |
Isotype: | IgG2a Kappa |
Gene id: | 30009 |
Gene name: | TBX21 |
Gene alias: | T-PET|T-bet|TBET|TBLYM |
Gene description: | T-box 21 |
Genbank accession: | BC039739 |
Immunogen: | TBX21 (AAH39739.1, 387 a.a. ~ 486 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYYRGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPE |
Protein accession: | AAH39739.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TBX21 expression in transfected 293T cell line by TBX21 monoclonal antibody (M09), clone 1D12. Lane 1: TBX21 transfected lysate(58.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |