TBX21 monoclonal antibody (M03), clone 4C11 View larger

TBX21 monoclonal antibody (M03), clone 4C11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TBX21 monoclonal antibody (M03), clone 4C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about TBX21 monoclonal antibody (M03), clone 4C11

Brand: Abnova
Reference: H00030009-M03
Product name: TBX21 monoclonal antibody (M03), clone 4C11
Product description: Mouse monoclonal antibody raised against a partial recombinant TBX21.
Clone: 4C11
Isotype: IgG2a Kappa
Gene id: 30009
Gene name: TBX21
Gene alias: T-PET|T-bet|TBET|TBLYM
Gene description: T-box 21
Genbank accession: BC039739
Immunogen: TBX21 (AAH39739.1, 387 a.a. ~ 486 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYYRGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPE
Protein accession: AAH39739.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00030009-M03-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged TBX21 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy TBX21 monoclonal antibody (M03), clone 4C11 now

Add to cart