Brand: | Abnova |
Reference: | H00030001-M01 |
Product name: | ERO1L monoclonal antibody (M01), clone 4G3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ERO1L. |
Clone: | 4G3 |
Isotype: | IgG2b Kappa |
Gene id: | 30001 |
Gene name: | ERO1L |
Gene alias: | ERO1-alpha |
Gene description: | ERO1-like (S. cerevisiae) |
Genbank accession: | NM_014584 |
Immunogen: | ERO1L (NP_055399, 90 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEY |
Protein accession: | NP_055399 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | ERO1L monoclonal antibody (M01), clone 4G3 Western Blot analysis of ERO1L expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Cancer-associated oxidoreductase ERO1-α drives the production of VEGF via oxidative protein folding and regulating the mRNA level.Tanaka T, Kutomi G, Kajiwara T, Kukita K, Kochin V, Kanaseki T, Tsukahara T, Hirohashi Y, Torigoe T, Okamoto Y, Hirata K, Sato N, Tamura Y. Br J Cancer. 2016 Apr 21. [Epub ahead of print] |