ERO1L monoclonal antibody (M01), clone 4G3 View larger

ERO1L monoclonal antibody (M01), clone 4G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ERO1L monoclonal antibody (M01), clone 4G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about ERO1L monoclonal antibody (M01), clone 4G3

Brand: Abnova
Reference: H00030001-M01
Product name: ERO1L monoclonal antibody (M01), clone 4G3
Product description: Mouse monoclonal antibody raised against a partial recombinant ERO1L.
Clone: 4G3
Isotype: IgG2b Kappa
Gene id: 30001
Gene name: ERO1L
Gene alias: ERO1-alpha
Gene description: ERO1-like (S. cerevisiae)
Genbank accession: NM_014584
Immunogen: ERO1L (NP_055399, 90 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEY
Protein accession: NP_055399
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00030001-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00030001-M01-1-1-1.jpg
Application image note: ERO1L monoclonal antibody (M01), clone 4G3 Western Blot analysis of ERO1L expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Cancer-associated oxidoreductase ERO1-α drives the production of VEGF via oxidative protein folding and regulating the mRNA level.Tanaka T, Kutomi G, Kajiwara T, Kukita K, Kochin V, Kanaseki T, Tsukahara T, Hirohashi Y, Torigoe T, Okamoto Y, Hirata K, Sato N, Tamura Y.
Br J Cancer. 2016 Apr 21. [Epub ahead of print]

Reviews

Buy ERO1L monoclonal antibody (M01), clone 4G3 now

Add to cart