GLTSCR2 monoclonal antibody (M03), clone 5A8 View larger

GLTSCR2 monoclonal antibody (M03), clone 5A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GLTSCR2 monoclonal antibody (M03), clone 5A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about GLTSCR2 monoclonal antibody (M03), clone 5A8

Brand: Abnova
Reference: H00029997-M03
Product name: GLTSCR2 monoclonal antibody (M03), clone 5A8
Product description: Mouse monoclonal antibody raised against a partial recombinant GLTSCR2.
Clone: 5A8
Isotype: IgG1 Kappa
Gene id: 29997
Gene name: GLTSCR2
Gene alias: PICT-1|PICT1
Gene description: glioma tumor suppressor candidate region gene 2
Genbank accession: NM_015710
Immunogen: GLTSCR2 (NP_056525, 402 a.a. ~ 478 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KPRRLGRLKYQAPDIDVQLSSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL
Protein accession: NP_056525
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029997-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029997-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged GLTSCR2 is approximately 0.1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Quantitative Proteomic profiling identifies protein correlates to EGFR kinase inhibition.Kani K, Faca VM, Hughes LD, Zhang W, Fang Q, Shahbaba B, Luethy R, Erde J, Schmidt J, Pitteri SJ, Zhang Q, Katz JE, Gross ME, Plevritis SK, McIntosh MW, Jain A, Hanash S, Agus DB, Mallick P.
Mol Cancer Ther. 2012 May;11(5):1071-81.

Reviews

Buy GLTSCR2 monoclonal antibody (M03), clone 5A8 now

Add to cart