Brand: | Abnova |
Reference: | H00029984-M12 |
Product name: | RHOD monoclonal antibody (M12), clone 1E7 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant RHOD. |
Clone: | 1E7 |
Isotype: | IgG2a Kappa |
Gene id: | 29984 |
Gene name: | RHOD |
Gene alias: | ARHD|RHOHP1|RHOM|Rho |
Gene description: | ras homolog gene family, member D |
Genbank accession: | BC001338 |
Immunogen: | RHOD (AAH01338, 1 a.a. ~ 210 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLRKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGFCVVT |
Protein accession: | AAH01338 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |