RHOD monoclonal antibody (M12), clone 1E7 View larger

RHOD monoclonal antibody (M12), clone 1E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RHOD monoclonal antibody (M12), clone 1E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about RHOD monoclonal antibody (M12), clone 1E7

Brand: Abnova
Reference: H00029984-M12
Product name: RHOD monoclonal antibody (M12), clone 1E7
Product description: Mouse monoclonal antibody raised against a full-length recombinant RHOD.
Clone: 1E7
Isotype: IgG2a Kappa
Gene id: 29984
Gene name: RHOD
Gene alias: ARHD|RHOHP1|RHOM|Rho
Gene description: ras homolog gene family, member D
Genbank accession: BC001338
Immunogen: RHOD (AAH01338, 1 a.a. ~ 210 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLRKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGFCVVT
Protein accession: AAH01338
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy RHOD monoclonal antibody (M12), clone 1E7 now

Add to cart