UBQLN2 monoclonal antibody (M03), clone 5F5 View larger

UBQLN2 monoclonal antibody (M03), clone 5F5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBQLN2 monoclonal antibody (M03), clone 5F5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about UBQLN2 monoclonal antibody (M03), clone 5F5

Brand: Abnova
Reference: H00029978-M03
Product name: UBQLN2 monoclonal antibody (M03), clone 5F5
Product description: Mouse monoclonal antibody raised against a partial recombinant UBQLN2.
Clone: 5F5
Isotype: IgG2a Kappa
Gene id: 29978
Gene name: UBQLN2
Gene alias: CHAP1|CHAP1/DSK2|Dsk2|HRIHFB2157|LIC-2|N4BP4|PLIC-2|PLIC2|RIHFB2157
Gene description: ubiquilin 2
Genbank accession: NM_013444
Immunogen: UBQLN2 (NP_038472, 555 a.a. ~ 624 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS
Protein accession: NP_038472
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029978-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00029978-M03-4-4-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to UBQLN2 on A-431 cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Pathogenic UBQLN2 gains toxic proterties to induce neuron death.Wu Q, Liu M, Huang C, Liu X, Huang B, Li N, Zhou H, Xia XG.
Acta Neuropathol. 2015 Nov 12;129(3):417-28.

Reviews

Buy UBQLN2 monoclonal antibody (M03), clone 5F5 now

Add to cart