Brand: | Abnova |
Reference: | H00029978-M03 |
Product name: | UBQLN2 monoclonal antibody (M03), clone 5F5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UBQLN2. |
Clone: | 5F5 |
Isotype: | IgG2a Kappa |
Gene id: | 29978 |
Gene name: | UBQLN2 |
Gene alias: | CHAP1|CHAP1/DSK2|Dsk2|HRIHFB2157|LIC-2|N4BP4|PLIC-2|PLIC2|RIHFB2157 |
Gene description: | ubiquilin 2 |
Genbank accession: | NM_013444 |
Immunogen: | UBQLN2 (NP_038472, 555 a.a. ~ 624 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS |
Protein accession: | NP_038472 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.44 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to UBQLN2 on A-431 cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Pathogenic UBQLN2 gains toxic proterties to induce neuron death.Wu Q, Liu M, Huang C, Liu X, Huang B, Li N, Zhou H, Xia XG. Acta Neuropathol. 2015 Nov 12;129(3):417-28. |