Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of UBQLN2 monoclonal antibody (M03), clone 5F5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about UBQLN2 monoclonal antibody (M03), clone 5F5
| Brand: | Abnova |
| Reference: | H00029978-M03 |
| Product name: | UBQLN2 monoclonal antibody (M03), clone 5F5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant UBQLN2. |
| Clone: | 5F5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 29978 |
| Gene name: | UBQLN2 |
| Gene alias: | CHAP1|CHAP1/DSK2|Dsk2|HRIHFB2157|LIC-2|N4BP4|PLIC-2|PLIC2|RIHFB2157 |
| Gene description: | ubiquilin 2 |
| Genbank accession: | NM_013444 |
| Immunogen: | UBQLN2 (NP_038472, 555 a.a. ~ 624 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS |
| Protein accession: | NP_038472 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.44 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to UBQLN2 on A-431 cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Pathogenic UBQLN2 gains toxic proterties to induce neuron death.Wu Q, Liu M, Huang C, Liu X, Huang B, Li N, Zhou H, Xia XG. Acta Neuropathol. 2015 Nov 12;129(3):417-28. |