PSAT1 monoclonal antibody (M01A), clone 1C2 View larger

PSAT1 monoclonal antibody (M01A), clone 1C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PSAT1 monoclonal antibody (M01A), clone 1C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PSAT1 monoclonal antibody (M01A), clone 1C2

Brand: Abnova
Reference: H00029968-M01A
Product name: PSAT1 monoclonal antibody (M01A), clone 1C2
Product description: Mouse monoclonal antibody raised against a partial recombinant PSAT1.
Clone: 1C2
Isotype: IgG2b Kappa
Gene id: 29968
Gene name: PSAT1
Gene alias: EPIP|MGC1460|PSA|PSAT
Gene description: phosphoserine aminotransferase 1
Genbank accession: NM_058179
Immunogen: PSAT1 (NP_478059, 262 a.a. ~ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL
Protein accession: NP_478059
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029968-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PSAT1 monoclonal antibody (M01A), clone 1C2 now

Add to cart