PSAT1 monoclonal antibody (M01), clone 1C2 View larger

PSAT1 monoclonal antibody (M01), clone 1C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PSAT1 monoclonal antibody (M01), clone 1C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about PSAT1 monoclonal antibody (M01), clone 1C2

Brand: Abnova
Reference: H00029968-M01
Product name: PSAT1 monoclonal antibody (M01), clone 1C2
Product description: Mouse monoclonal antibody raised against a partial recombinant PSAT1.
Clone: 1C2
Isotype: IgG2b Kappa
Gene id: 29968
Gene name: PSAT1
Gene alias: EPIP|MGC1460|PSA|PSAT
Gene description: phosphoserine aminotransferase 1
Genbank accession: NM_058179
Immunogen: PSAT1 (NP_478059, 262 a.a. ~ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL
Protein accession: NP_478059
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029968-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged PSAT1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy PSAT1 monoclonal antibody (M01), clone 1C2 now

Add to cart