STRN3 monoclonal antibody (M03), clone 3A5 View larger

STRN3 monoclonal antibody (M03), clone 3A5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STRN3 monoclonal antibody (M03), clone 3A5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about STRN3 monoclonal antibody (M03), clone 3A5

Brand: Abnova
Reference: H00029966-M03
Product name: STRN3 monoclonal antibody (M03), clone 3A5
Product description: Mouse monoclonal antibody raised against a partial recombinant STRN3.
Clone: 3A5
Isotype: IgG2b Kappa
Gene id: 29966
Gene name: STRN3
Gene alias: SG2NA
Gene description: striatin, calmodulin binding protein 3
Genbank accession: NM_014574
Immunogen: STRN3 (NP_055389, 614 a.a. ~ 713 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHSSKAYIASAGADALAKVFV
Protein accession: NP_055389
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029966-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged STRN3 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy STRN3 monoclonal antibody (M03), clone 3A5 now

Add to cart