Brand: | Abnova |
Reference: | H00029966-M03 |
Product name: | STRN3 monoclonal antibody (M03), clone 3A5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant STRN3. |
Clone: | 3A5 |
Isotype: | IgG2b Kappa |
Gene id: | 29966 |
Gene name: | STRN3 |
Gene alias: | SG2NA |
Gene description: | striatin, calmodulin binding protein 3 |
Genbank accession: | NM_014574 |
Immunogen: | STRN3 (NP_055389, 614 a.a. ~ 713 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHSSKAYIASAGADALAKVFV |
Protein accession: | NP_055389 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged STRN3 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |