Brand: | Abnova |
Reference: | H00029959-M02 |
Product name: | NRBP1 monoclonal antibody (M02), clone 2B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NRBP1. |
Clone: | 2B4 |
Isotype: | IgG2a Kappa |
Gene id: | 29959 |
Gene name: | NRBP1 |
Gene alias: | BCON3|FLJ27109|FLJ35541|MADM|MUDPNP|NRBP |
Gene description: | nuclear receptor binding protein 1 |
Genbank accession: | BC001221 |
Immunogen: | NRBP1 (AAH01221, 436 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNENIPELAAELVQLGFISEADQSRLTSLLEETLNKFNFARNSTLNSAAVTVSS |
Protein accession: | AAH01221 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NRBP1 monoclonal antibody (M02), clone 2B4 Western Blot analysis of NRBP1 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA |
Shipping condition: | Dry Ice |