NRBP1 monoclonal antibody (M02), clone 2B4 View larger

NRBP1 monoclonal antibody (M02), clone 2B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NRBP1 monoclonal antibody (M02), clone 2B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA

More info about NRBP1 monoclonal antibody (M02), clone 2B4

Brand: Abnova
Reference: H00029959-M02
Product name: NRBP1 monoclonal antibody (M02), clone 2B4
Product description: Mouse monoclonal antibody raised against a partial recombinant NRBP1.
Clone: 2B4
Isotype: IgG2a Kappa
Gene id: 29959
Gene name: NRBP1
Gene alias: BCON3|FLJ27109|FLJ35541|MADM|MUDPNP|NRBP
Gene description: nuclear receptor binding protein 1
Genbank accession: BC001221
Immunogen: NRBP1 (AAH01221, 436 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNENIPELAAELVQLGFISEADQSRLTSLLEETLNKFNFARNSTLNSAAVTVSS
Protein accession: AAH01221
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029959-M02-1-6-1.jpg
Application image note: NRBP1 monoclonal antibody (M02), clone 2B4 Western Blot analysis of NRBP1 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy NRBP1 monoclonal antibody (M02), clone 2B4 now

Add to cart