NRBP1 monoclonal antibody (M01), clone 4D2 View larger

NRBP1 monoclonal antibody (M01), clone 4D2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NRBP1 monoclonal antibody (M01), clone 4D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about NRBP1 monoclonal antibody (M01), clone 4D2

Brand: Abnova
Reference: H00029959-M01
Product name: NRBP1 monoclonal antibody (M01), clone 4D2
Product description: Mouse monoclonal antibody raised against a partial recombinant NRBP1.
Clone: 4D2
Isotype: IgG2a Kappa
Gene id: 29959
Gene name: NRBP1
Gene alias: BCON3|FLJ27109|FLJ35541|MADM|MUDPNP|NRBP
Gene description: nuclear receptor binding protein 1
Genbank accession: BC001221
Immunogen: NRBP1 (AAH01221, 436 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNENIPELAAELVQLGFISEADQSRLTSLLEETLNKFNFARNSTLNSAAVTVSS
Protein accession: AAH01221
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029959-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029959-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to NRBP1 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Nuclear receptor binding protein 1 correlates with better prognosis and induces caspase-dependent intrinsic apoptosis through the JNK signalling pathway in colorectal cancer.Liao Y, Yang Z, Huang J, Chen H, Xiang J, Li S, Chen C, He X, Lin F, Yang Z, Wang J.
Cell Death Dis. 2018 Mar 22;9(4):436.

Reviews

Buy NRBP1 monoclonal antibody (M01), clone 4D2 now

Add to cart