SLC25A24 monoclonal antibody (M01), clone 2C4 View larger

SLC25A24 monoclonal antibody (M01), clone 2C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC25A24 monoclonal antibody (M01), clone 2C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SLC25A24 monoclonal antibody (M01), clone 2C4

Brand: Abnova
Reference: H00029957-M01
Product name: SLC25A24 monoclonal antibody (M01), clone 2C4
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC25A24.
Clone: 2C4
Isotype: IgG2a Kappa
Gene id: 29957
Gene name: SLC25A24
Gene alias: APC1|DKFZp586G0123|SCAMC-1
Gene description: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24
Genbank accession: NM_013386
Immunogen: SLC25A24 (NP_037518.2, 1 a.a. ~ 66 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTT
Protein accession: NP_037518.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029957-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029957-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SLC25A24 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC25A24 monoclonal antibody (M01), clone 2C4 now

Add to cart