POMT2 monoclonal antibody (M01), clone 1D9 View larger

POMT2 monoclonal antibody (M01), clone 1D9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of POMT2 monoclonal antibody (M01), clone 1D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about POMT2 monoclonal antibody (M01), clone 1D9

Brand: Abnova
Reference: H00029954-M01
Product name: POMT2 monoclonal antibody (M01), clone 1D9
Product description: Mouse monoclonal antibody raised against a partial recombinant POMT2.
Clone: 1D9
Isotype: IgG2a Kappa
Gene id: 29954
Gene name: POMT2
Gene alias: DKFZp686G10254|FLJ22309
Gene description: protein-O-mannosyltransferase 2
Genbank accession: NM_013382
Immunogen: POMT2 (NP_037514, 483 a.a. ~ 580 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CVLGSSGKVLPKWGWEQLEVTCTPYLKETLNSIWNVEDHINPKLPNISLDVLQPSFPEILLESHMVMIRGNSGLKPKDNEFTSKPWHWPINYQGLRFS
Protein accession: NP_037514
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029954-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029954-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged POMT2 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy POMT2 monoclonal antibody (M01), clone 1D9 now

Add to cart