SERTAD1 monoclonal antibody (M07), clone 3H4 View larger

SERTAD1 monoclonal antibody (M07), clone 3H4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SERTAD1 monoclonal antibody (M07), clone 3H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about SERTAD1 monoclonal antibody (M07), clone 3H4

Brand: Abnova
Reference: H00029950-M07
Product name: SERTAD1 monoclonal antibody (M07), clone 3H4
Product description: Mouse monoclonal antibody raised against a full-length recombinant SERTAD1.
Clone: 3H4
Isotype: IgG2a Kappa
Gene id: 29950
Gene name: SERTAD1
Gene alias: SEI1|TRIP-Br1
Gene description: SERTA domain containing 1
Genbank accession: BC002670
Immunogen: SERTAD1 (AAH02670, 1 a.a. ~ 236 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MLSKGLKRKREEEEEKEPLAVDSWWLDPGHTAVAQAPPAVASSSLFDLSVLKLHHSPQQSEPDLRHLVLVVNTLRRIQASMAPAAALPPVPSPPAAPSVADNLLASSDAALSASMASLLEDLSHIEGLSQAPQPLADEGPPGRSIGGAAPSLGALDLLGPATGCLLDDGLEGLFEDIDTSMYDNELWAPASEGLKPGPEDGPGKEEAPELDEAELDYLMDVLVGTQALERPPGPGR
Protein accession: AAH02670
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029950-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (51.7 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029950-M07-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SERTAD1 is 0.1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SERTAD1 monoclonal antibody (M07), clone 3H4 now

Add to cart