Brand: | Abnova |
Reference: | H00029950-M07 |
Product name: | SERTAD1 monoclonal antibody (M07), clone 3H4 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SERTAD1. |
Clone: | 3H4 |
Isotype: | IgG2a Kappa |
Gene id: | 29950 |
Gene name: | SERTAD1 |
Gene alias: | SEI1|TRIP-Br1 |
Gene description: | SERTA domain containing 1 |
Genbank accession: | BC002670 |
Immunogen: | SERTAD1 (AAH02670, 1 a.a. ~ 236 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLSKGLKRKREEEEEKEPLAVDSWWLDPGHTAVAQAPPAVASSSLFDLSVLKLHHSPQQSEPDLRHLVLVVNTLRRIQASMAPAAALPPVPSPPAAPSVADNLLASSDAALSASMASLLEDLSHIEGLSQAPQPLADEGPPGRSIGGAAPSLGALDLLGPATGCLLDDGLEGLFEDIDTSMYDNELWAPASEGLKPGPEDGPGKEEAPELDEAELDYLMDVLVGTQALERPPGPGR |
Protein accession: | AAH02670 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (51.7 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SERTAD1 is 0.1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |