DSE monoclonal antibody (M03), clone 6D4 View larger

DSE monoclonal antibody (M03), clone 6D4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DSE monoclonal antibody (M03), clone 6D4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about DSE monoclonal antibody (M03), clone 6D4

Brand: Abnova
Reference: H00029940-M03
Product name: DSE monoclonal antibody (M03), clone 6D4
Product description: Mouse monoclonal antibody raised against a partial recombinant DSE.
Clone: 6D4
Isotype: IgG2a Kappa
Gene id: 29940
Gene name: DSE
Gene alias: DSEPI|SART2
Gene description: dermatan sulfate epimerase
Genbank accession: NM_013352
Immunogen: DSE (NP_037484, 574 a.a. ~ 673 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LGEESPLETAASFFHNVDVPFEETVVDGVHGAFIRQRDGLYKMYWMDDTGYSEKATFASVTYPRGYPYNGTNYVNVTMHLRSPITRAAYLFIGPSIDVQS
Protein accession: NP_037484
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029940-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029940-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged DSE is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DSE monoclonal antibody (M03), clone 6D4 now

Add to cart