Brand: | Abnova |
Reference: | H00029934-M01 |
Product name: | SNX12 monoclonal antibody (M01), clone 2C10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SNX12. |
Clone: | 2C10 |
Isotype: | IgG2a Kappa |
Gene id: | 29934 |
Gene name: | SNX12 |
Gene alias: | MGC118982|MGC118983 |
Gene description: | sorting nexin 12 |
Genbank accession: | BC020559 |
Immunogen: | SNX12 (AAH20559, 53 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGK |
Protein accession: | AAH20559 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.4 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SNX12 monoclonal antibody (M01), clone 2C10 Western Blot analysis of SNX12 expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |