SNX12 monoclonal antibody (M01), clone 2C10 View larger

SNX12 monoclonal antibody (M01), clone 2C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNX12 monoclonal antibody (M01), clone 2C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about SNX12 monoclonal antibody (M01), clone 2C10

Brand: Abnova
Reference: H00029934-M01
Product name: SNX12 monoclonal antibody (M01), clone 2C10
Product description: Mouse monoclonal antibody raised against a partial recombinant SNX12.
Clone: 2C10
Isotype: IgG2a Kappa
Gene id: 29934
Gene name: SNX12
Gene alias: MGC118982|MGC118983
Gene description: sorting nexin 12
Genbank accession: BC020559
Immunogen: SNX12 (AAH20559, 53 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGK
Protein accession: AAH20559
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029934-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.4 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029934-M01-1-2-1.jpg
Application image note: SNX12 monoclonal antibody (M01), clone 2C10 Western Blot analysis of SNX12 expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SNX12 monoclonal antibody (M01), clone 2C10 now

Add to cart