PCDHB1 monoclonal antibody (M01A), clone 1H4 View larger

PCDHB1 monoclonal antibody (M01A), clone 1H4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCDHB1 monoclonal antibody (M01A), clone 1H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PCDHB1 monoclonal antibody (M01A), clone 1H4

Brand: Abnova
Reference: H00029930-M01A
Product name: PCDHB1 monoclonal antibody (M01A), clone 1H4
Product description: Mouse monoclonal antibody raised against a partial recombinant PCDHB1.
Clone: 1H4
Isotype: IgM Kappa
Gene id: 29930
Gene name: PCDHB1
Gene alias: MGC138301|MGC138303|PCDH-BETA1
Gene description: protocadherin beta 1
Genbank accession: NM_013340
Immunogen: PCDHB1 (NP_037472, 241 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QFSRLVYRAQVSENSPNGSLVATVTAVDLDEGTNKAITYSLAQNPEAILKTFQIDPQNGEVRLRGPLDFEAIETYDIDIQATDGGGLSAHSKVLVEVVDV
Protein accession: NP_037472
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029930-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCDHB1 monoclonal antibody (M01A), clone 1H4 now

Add to cart