Brand: | Abnova |
Reference: | H00029930-M01A |
Product name: | PCDHB1 monoclonal antibody (M01A), clone 1H4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PCDHB1. |
Clone: | 1H4 |
Isotype: | IgM Kappa |
Gene id: | 29930 |
Gene name: | PCDHB1 |
Gene alias: | MGC138301|MGC138303|PCDH-BETA1 |
Gene description: | protocadherin beta 1 |
Genbank accession: | NM_013340 |
Immunogen: | PCDHB1 (NP_037472, 241 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QFSRLVYRAQVSENSPNGSLVATVTAVDLDEGTNKAITYSLAQNPEAILKTFQIDPQNGEVRLRGPLDFEAIETYDIDIQATDGGGLSAHSKVLVEVVDV |
Protein accession: | NP_037472 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |