Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ALG6 monoclonal antibody (M09), clone 2G11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,ELISA |
More info about ALG6 monoclonal antibody (M09), clone 2G11
| Brand: | Abnova |
| Reference: | H00029929-M09 |
| Product name: | ALG6 monoclonal antibody (M09), clone 2G11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ALG6. |
| Clone: | 2G11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 29929 |
| Gene name: | ALG6 |
| Gene alias: | - |
| Gene description: | asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S. cerevisiae) |
| Genbank accession: | NM_013339 |
| Immunogen: | ALG6 (NP_037471, 25 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRT |
| Protein accession: | NP_037471 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ALG6 monoclonal antibody (M09), clone 2G11 Western Blot analysis of ALG6 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,ELISA |
| Shipping condition: | Dry Ice |