Brand: | Abnova |
Reference: | H00029929-M09 |
Product name: | ALG6 monoclonal antibody (M09), clone 2G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ALG6. |
Clone: | 2G11 |
Isotype: | IgG2a Kappa |
Gene id: | 29929 |
Gene name: | ALG6 |
Gene alias: | - |
Gene description: | asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S. cerevisiae) |
Genbank accession: | NM_013339 |
Immunogen: | ALG6 (NP_037471, 25 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRT |
Protein accession: | NP_037471 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00029929-M09-1-25-1.jpg](http://www.abnova.com/application_image/H00029929-M09-1-25-1.jpg) |
Application image note: | ALG6 monoclonal antibody (M09), clone 2G11 Western Blot analysis of ALG6 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IF,ELISA |
Shipping condition: | Dry Ice |