GMPPB monoclonal antibody (M07), clone 2B5 View larger

GMPPB monoclonal antibody (M07), clone 2B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GMPPB monoclonal antibody (M07), clone 2B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about GMPPB monoclonal antibody (M07), clone 2B5

Brand: Abnova
Reference: H00029925-M07
Product name: GMPPB monoclonal antibody (M07), clone 2B5
Product description: Mouse monoclonal antibody raised against a partial recombinant GMPPB.
Clone: 2B5
Isotype: IgG2b Kappa
Gene id: 29925
Gene name: GMPPB
Gene alias: KIAA1851
Gene description: GDP-mannose pyrophosphorylase B
Genbank accession: NM_013334
Immunogen: GMPPB (NP_037466, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQVLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSETADPFFVLNSD
Protein accession: NP_037466
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029925-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029925-M07-3-47-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to GMPPB on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GMPPB monoclonal antibody (M07), clone 2B5 now

Add to cart