NME7 monoclonal antibody (M08A), clone 1A11 View larger

NME7 monoclonal antibody (M08A), clone 1A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NME7 monoclonal antibody (M08A), clone 1A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about NME7 monoclonal antibody (M08A), clone 1A11

Brand: Abnova
Reference: H00029922-M08A
Product name: NME7 monoclonal antibody (M08A), clone 1A11
Product description: Mouse monoclonal antibody raised against a partial recombinant NME7.
Clone: 1A11
Isotype: IgG1 Kappa
Gene id: 29922
Gene name: NME7
Gene alias: FLJ37194|nm23-H7
Gene description: non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase)
Genbank accession: NM_013330
Immunogen: NME7 (NP_004547, 277 a.a. ~ 374 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKIL
Protein accession: NP_004547
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy NME7 monoclonal antibody (M08A), clone 1A11 now

Add to cart