Brand: | Abnova |
Reference: | H00029922-M08A |
Product name: | NME7 monoclonal antibody (M08A), clone 1A11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NME7. |
Clone: | 1A11 |
Isotype: | IgG1 Kappa |
Gene id: | 29922 |
Gene name: | NME7 |
Gene alias: | FLJ37194|nm23-H7 |
Gene description: | non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase) |
Genbank accession: | NM_013330 |
Immunogen: | NME7 (NP_004547, 277 a.a. ~ 374 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKIL |
Protein accession: | NP_004547 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |