NME7 monoclonal antibody (M08), clone 1A11 View larger

NME7 monoclonal antibody (M08), clone 1A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NME7 monoclonal antibody (M08), clone 1A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about NME7 monoclonal antibody (M08), clone 1A11

Brand: Abnova
Reference: H00029922-M08
Product name: NME7 monoclonal antibody (M08), clone 1A11
Product description: Mouse monoclonal antibody raised against a partial recombinant NME7.
Clone: 1A11
Isotype: IgG2b Kappa
Gene id: 29922
Gene name: NME7
Gene alias: FLJ37194|nm23-H7
Gene description: non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase)
Genbank accession: NM_013330
Immunogen: NME7 (NP_004547, 277 a.a. ~ 374 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKIL
Protein accession: NP_004547
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029922-M08-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged NME7 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy NME7 monoclonal antibody (M08), clone 1A11 now

Add to cart