SNX11 monoclonal antibody (M05), clone 2G1 View larger

SNX11 monoclonal antibody (M05), clone 2G1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNX11 monoclonal antibody (M05), clone 2G1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about SNX11 monoclonal antibody (M05), clone 2G1

Brand: Abnova
Reference: H00029916-M05
Product name: SNX11 monoclonal antibody (M05), clone 2G1
Product description: Mouse monoclonal antibody raised against a full-length recombinant SNX11.
Clone: 2G1
Isotype: IgG2a Kappa
Gene id: 29916
Gene name: SNX11
Gene alias: MGC111019
Gene description: sorting nexin 11
Genbank accession: BC000768
Immunogen: SNX11 (AAH00768, 1 a.a. ~ 270 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGFWCRMSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKSCCFLPRSGRRSSPSPPPSEEKDHLEVWAPVVDSEVPSLESPTLPPLSSPLCCDFGRPKEGTSTLQSVRRAVGGDHAVPLDPGQLETVLEK
Protein accession: AAH00768
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029916-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (55.44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029916-M05-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SNX11 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy SNX11 monoclonal antibody (M05), clone 2G1 now

Add to cart