HOOK2 monoclonal antibody (M03), clone 1E10 View larger

HOOK2 monoclonal antibody (M03), clone 1E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HOOK2 monoclonal antibody (M03), clone 1E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about HOOK2 monoclonal antibody (M03), clone 1E10

Brand: Abnova
Reference: H00029911-M03
Product name: HOOK2 monoclonal antibody (M03), clone 1E10
Product description: Mouse monoclonal antibody raised against a partial recombinant HOOK2.
Clone: 1E10
Isotype: IgG1 Kappa
Gene id: 29911
Gene name: HOOK2
Gene alias: FLJ26218|HK2
Gene description: hook homolog 2 (Drosophila)
Genbank accession: NM_013312
Immunogen: HOOK2 (NP_037444, 138 a.a. ~ 237 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LEESVQHVVMEAIQELMTKDTPDSLSPETYGNFDSQSRRYYFLSEEAEEGDELQQRCLDLERQLMLLSEEKQSLAQENAGLRERMGRPEGEGTPGLTAKK
Protein accession: NP_037444
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029911-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HOOK2 monoclonal antibody (M03), clone 1E10 now

Add to cart