SNX15 monoclonal antibody (M01), clone 1D4 View larger

SNX15 monoclonal antibody (M01), clone 1D4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNX15 monoclonal antibody (M01), clone 1D4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about SNX15 monoclonal antibody (M01), clone 1D4

Brand: Abnova
Reference: H00029907-M01
Product name: SNX15 monoclonal antibody (M01), clone 1D4
Product description: Mouse monoclonal antibody raised against a partial recombinant SNX15.
Clone: 1D4
Isotype: IgG3 Kappa
Gene id: 29907
Gene name: SNX15
Gene alias: HSAF001435
Gene description: sorting nexin 15
Genbank accession: NM_013306
Immunogen: SNX15 (NP_037438, 51 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RYSDFRKLHGDLAYTHRNLFRRLEEFPAFPRAQVFGRFEASVIEERRKGAEDLLRFTVHIPALNNSPQLKEFFRGGEVTRPLEVSRDLH
Protein accession: NP_037438
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029907-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029907-M01-13-15-1.jpg
Application image note: Western Blot analysis of SNX15 expression in transfected 293T cell line by SNX15 monoclonal antibody (M01), clone 1D4.

Lane 1: SNX15 transfected lysate (Predicted MW: 38.3 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SNX15 monoclonal antibody (M01), clone 1D4 now

Add to cart