MYLPF monoclonal antibody (M05), clone 3H3 View larger

MYLPF monoclonal antibody (M05), clone 3H3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MYLPF monoclonal antibody (M05), clone 3H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Tr

More info about MYLPF monoclonal antibody (M05), clone 3H3

Brand: Abnova
Reference: H00029895-M05
Product name: MYLPF monoclonal antibody (M05), clone 3H3
Product description: Mouse monoclonal antibody raised against a full-length recombinant MYLPF.
Clone: 3H3
Isotype: IgG2a Kappa
Gene id: 29895
Gene name: MYLPF
Gene alias: DKFZp779C0757|MGC13450|MRLC2
Gene description: fast skeletal myosin light chain 2
Genbank accession: BC012571
Immunogen: MYLPF (AAH12571, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
Protein accession: AAH12571
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029895-M05-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged MYLPF is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MYLPF monoclonal antibody (M05), clone 3H3 now

Add to cart