Brand: | Abnova |
Reference: | H00029895-M05 |
Product name: | MYLPF monoclonal antibody (M05), clone 3H3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant MYLPF. |
Clone: | 3H3 |
Isotype: | IgG2a Kappa |
Gene id: | 29895 |
Gene name: | MYLPF |
Gene alias: | DKFZp779C0757|MGC13450|MRLC2 |
Gene description: | fast skeletal myosin light chain 2 |
Genbank accession: | BC012571 |
Immunogen: | MYLPF (AAH12571, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE |
Protein accession: | AAH12571 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MYLPF is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Tr |
Shipping condition: | Dry Ice |