CNOT7 monoclonal antibody (M03), clone 2C4 View larger

CNOT7 monoclonal antibody (M03), clone 2C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CNOT7 monoclonal antibody (M03), clone 2C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about CNOT7 monoclonal antibody (M03), clone 2C4

Brand: Abnova
Reference: H00029883-M03
Product name: CNOT7 monoclonal antibody (M03), clone 2C4
Product description: Mouse monoclonal antibody raised against a full-length recombinant CNOT7.
Clone: 2C4
Isotype: IgG1 Kappa
Gene id: 29883
Gene name: CNOT7
Gene alias: CAF1|hCAF-1
Gene description: CCR4-NOT transcription complex, subunit 7
Genbank accession: BC060852
Immunogen: CNOT7 (AAH60852, 1 a.a. ~ 285 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS
Protein accession: AAH60852
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029883-M03-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged CNOT7 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy CNOT7 monoclonal antibody (M03), clone 2C4 now

Add to cart