Brand: | Abnova |
Reference: | H00029883-M01A |
Product name: | CNOT7 monoclonal antibody (M01A), clone 2F6 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant CNOT7. |
Clone: | 2F6 |
Isotype: | IgG2a Kappa |
Gene id: | 29883 |
Gene name: | CNOT7 |
Gene alias: | CAF1|hCAF-1 |
Gene description: | CCR4-NOT transcription complex, subunit 7 |
Genbank accession: | BC060852 |
Immunogen: | CNOT7 (AAH60852, 1 a.a. ~ 285 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS |
Protein accession: | AAH60852 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (57.09 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | CNOT7 monoclonal antibody (M01A), clone 2F6 Western Blot analysis of CNOT7 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |