CNOT7 monoclonal antibody (M01), clone 2F6 View larger

CNOT7 monoclonal antibody (M01), clone 2F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CNOT7 monoclonal antibody (M01), clone 2F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about CNOT7 monoclonal antibody (M01), clone 2F6

Brand: Abnova
Reference: H00029883-M01
Product name: CNOT7 monoclonal antibody (M01), clone 2F6
Product description: Mouse monoclonal antibody raised against a full length recombinant CNOT7.
Clone: 2F6
Isotype: IgG2a Kappa
Gene id: 29883
Gene name: CNOT7
Gene alias: CAF1|hCAF-1
Gene description: CCR4-NOT transcription complex, subunit 7
Genbank accession: BC060852
Immunogen: CNOT7 (AAH60852, 1 a.a. ~ 285 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS
Protein accession: AAH60852
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029883-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (57.09 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00029883-M01-1-1-1.jpg
Application image note: CNOT7 monoclonal antibody (M01), clone 2F6 Western Blot analysis of CNOT7 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Phase Transitions in the Assembly and Function of Human miRISC.Sheu-Gruttadauria J, MacRae IJ.
Cell. 2018 Mar 16. [Epub ahead of print]

Reviews

Buy CNOT7 monoclonal antibody (M01), clone 2F6 now

Add to cart