ANAPC2 monoclonal antibody (M02), clone 7F2 View larger

ANAPC2 monoclonal antibody (M02), clone 7F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANAPC2 monoclonal antibody (M02), clone 7F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ANAPC2 monoclonal antibody (M02), clone 7F2

Brand: Abnova
Reference: H00029882-M02
Product name: ANAPC2 monoclonal antibody (M02), clone 7F2
Product description: Mouse monoclonal antibody raised against a partial recombinant ANAPC2.
Clone: 7F2
Isotype: IgG1 Kappa
Gene id: 29882
Gene name: ANAPC2
Gene alias: APC2|RP11-350O14.5
Gene description: anaphase promoting complex subunit 2
Genbank accession: NM_013366
Immunogen: ANAPC2 (NP_037498, 716 a.a. ~ 822 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IEEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS
Protein accession: NP_037498
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029882-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ANAPC2 monoclonal antibody (M02), clone 7F2 now

Add to cart