ICOS monoclonal antibody (M02), clone 3G4 View larger

ICOS monoclonal antibody (M02), clone 3G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ICOS monoclonal antibody (M02), clone 3G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ICOS monoclonal antibody (M02), clone 3G4

Brand: Abnova
Reference: H00029851-M02
Product name: ICOS monoclonal antibody (M02), clone 3G4
Product description: Mouse monoclonal antibody raised against a partial recombinant ICOS.
Clone: 3G4
Isotype: IgG2a Kappa
Gene id: 29851
Gene name: ICOS
Gene alias: AILIM|CD278|MGC39850
Gene description: inducible T-cell co-stimulator
Genbank accession: NM_012092.2
Immunogen: ICOS (NP_036224.1, 21 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK
Protein accession: NP_036224.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029851-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.83 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029851-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ICOS is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ICOS monoclonal antibody (M02), clone 3G4 now

Add to cart