ICOS monoclonal antibody (M01), clone 1G1 View larger

ICOS monoclonal antibody (M01), clone 1G1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ICOS monoclonal antibody (M01), clone 1G1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ICOS monoclonal antibody (M01), clone 1G1

Brand: Abnova
Reference: H00029851-M01
Product name: ICOS monoclonal antibody (M01), clone 1G1
Product description: Mouse monoclonal antibody raised against a full-length recombinant ICOS.
Clone: 1G1
Isotype: IgG2b Kappa
Gene id: 29851
Gene name: ICOS
Gene alias: AILIM|CD278|MGC39850
Gene description: inducible T-cell co-stimulator
Genbank accession: BC028006
Immunogen: ICOS (AAH28006, 1 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKM
Protein accession: AAH28006
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged ICOS is approximately 10ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ICOS monoclonal antibody (M01), clone 1G1 now

Add to cart