VPREB3 monoclonal antibody (M08), clone 4H8 View larger

VPREB3 monoclonal antibody (M08), clone 4H8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VPREB3 monoclonal antibody (M08), clone 4H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about VPREB3 monoclonal antibody (M08), clone 4H8

Brand: Abnova
Reference: H00029802-M08
Product name: VPREB3 monoclonal antibody (M08), clone 4H8
Product description: Mouse monoclonal antibody raised against a partial recombinant VPREB3.
Clone: 4H8
Isotype: IgG1 Kappa
Gene id: 29802
Gene name: VPREB3
Gene alias: 8HS20|N27C7-2
Gene description: pre-B lymphocyte 3
Genbank accession: NM_013378
Immunogen: VPREB3 (NP_037510, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP
Protein accession: NP_037510
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029802-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029802-M08-13-15-1.jpg
Application image note: Western Blot analysis of VPREB3 expression in transfected 293T cell line by VPREB3 monoclonal antibody (M08), clone 4H8.

Lane 1: VPREB3 transfected lysate(13.7 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy VPREB3 monoclonal antibody (M08), clone 4H8 now

Add to cart