Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00029802-M08 |
Product name: | VPREB3 monoclonal antibody (M08), clone 4H8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant VPREB3. |
Clone: | 4H8 |
Isotype: | IgG1 Kappa |
Gene id: | 29802 |
Gene name: | VPREB3 |
Gene alias: | 8HS20|N27C7-2 |
Gene description: | pre-B lymphocyte 3 |
Genbank accession: | NM_013378 |
Immunogen: | VPREB3 (NP_037510, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP |
Protein accession: | NP_037510 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of VPREB3 expression in transfected 293T cell line by VPREB3 monoclonal antibody (M08), clone 4H8. Lane 1: VPREB3 transfected lysate(13.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |