ZDHHC8 monoclonal antibody (M03), clone 1G8 View larger

ZDHHC8 monoclonal antibody (M03), clone 1G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZDHHC8 monoclonal antibody (M03), clone 1G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ZDHHC8 monoclonal antibody (M03), clone 1G8

Brand: Abnova
Reference: H00029801-M03
Product name: ZDHHC8 monoclonal antibody (M03), clone 1G8
Product description: Mouse monoclonal antibody raised against a full-length recombinant ZDHHC8.
Clone: 1G8
Isotype: IgG1 Kappa
Gene id: 29801
Gene name: ZDHHC8
Gene alias: ZDHHCL1|ZNF378
Gene description: zinc finger, DHHC-type containing 8
Genbank accession: BC009442
Immunogen: ZDHHC8 (AAH09442, 1 a.a. ~ 42 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDRGTQGPHRPSDTACGLPDRVSPARLLLTNALPFTDPAGSL
Protein accession: AAH09442
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029801-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (30.36 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029801-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged ZDHHC8 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZDHHC8 monoclonal antibody (M03), clone 1G8 now

Add to cart