Brand: | Abnova |
Reference: | H00029766-M10 |
Product name: | TMOD3 monoclonal antibody (M10), clone 1E1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TMOD3. |
Clone: | 1E1 |
Isotype: | IgG2a Kappa |
Gene id: | 29766 |
Gene name: | TMOD3 |
Gene alias: | UTMOD |
Gene description: | tropomodulin 3 (ubiquitous) |
Genbank accession: | NM_014547 |
Immunogen: | TMOD3 (NP_055362, 280 a.a. ~ 352 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RDNETLAELKIDNQRQQLGTAVELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRVEGDHQ |
Protein accession: | NP_055362 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.77 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TMOD3 monoclonal antibody (M10), clone 1E1. Western Blot analysis of TMOD3 expression in human kidney. |
Applications: | WB-Ti,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |