TMOD3 monoclonal antibody (M10), clone 1E1 View larger

TMOD3 monoclonal antibody (M10), clone 1E1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMOD3 monoclonal antibody (M10), clone 1E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about TMOD3 monoclonal antibody (M10), clone 1E1

Brand: Abnova
Reference: H00029766-M10
Product name: TMOD3 monoclonal antibody (M10), clone 1E1
Product description: Mouse monoclonal antibody raised against a partial recombinant TMOD3.
Clone: 1E1
Isotype: IgG2a Kappa
Gene id: 29766
Gene name: TMOD3
Gene alias: UTMOD
Gene description: tropomodulin 3 (ubiquitous)
Genbank accession: NM_014547
Immunogen: TMOD3 (NP_055362, 280 a.a. ~ 352 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RDNETLAELKIDNQRQQLGTAVELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRVEGDHQ
Protein accession: NP_055362
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029766-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.77 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029766-M10-2-A0-1.jpg
Application image note: TMOD3 monoclonal antibody (M10), clone 1E1. Western Blot analysis of TMOD3 expression in human kidney.
Applications: WB-Ti,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TMOD3 monoclonal antibody (M10), clone 1E1 now

Add to cart