BLNK monoclonal antibody (M04), clone 1D7 View larger

BLNK monoclonal antibody (M04), clone 1D7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BLNK monoclonal antibody (M04), clone 1D7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,ELISA,WB-Re,PLA-Ce

More info about BLNK monoclonal antibody (M04), clone 1D7

Brand: Abnova
Reference: H00029760-M04
Product name: BLNK monoclonal antibody (M04), clone 1D7
Product description: Mouse monoclonal antibody raised against a partial recombinant BLNK.
Clone: 1D7
Isotype: IgG2a Kappa
Gene id: 29760
Gene name: BLNK
Gene alias: BASH|BLNK-S|LY57|MGC111051|SLP-65|SLP65
Gene description: B-cell linker
Genbank accession: BC018906
Immunogen: BLNK (AAH18906, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRF
Protein accession: AAH18906
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029760-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00029760-M04-57-1-1.jpg
Application image note: Proximity Ligation Analysis of protein-protein interactions between NCK1 and BLNK. HeLa cells were stained with anti-NCK1 rabbit purified polyclonal 1:1200 and anti-BLNK mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Applications: WB-Ce,WB-Ti,ELISA,WB-Re,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy BLNK monoclonal antibody (M04), clone 1D7 now

Add to cart