Brand: | Abnova |
Reference: | H00029128-M02 |
Product name: | UHRF1 monoclonal antibody (M02), clone 3B12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UHRF1. |
Clone: | 3B12 |
Isotype: | IgG1 Kappa |
Gene id: | 29128 |
Gene name: | UHRF1 |
Gene alias: | FLJ21925|ICBP90|MGC138707|Np95|RNF106|hNP95 |
Gene description: | ubiquitin-like with PHD and ring finger domains 1 |
Genbank accession: | NM_013282 |
Immunogen: | UHRF1 (NP_037414, 694 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR |
Protein accession: | NP_037414 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to UHRF1 on MCF-7 cell . [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |